GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Hematite Polished Tumble Stone

Hematite Polished Tumble Stone

£2.50 inc. tax

Hematite polished tumble stone is a grey heavy crystal. Helps with grounding us and connecting with earth. 

Hematite supports Base chakra.


Associated with star signs Aquarius.

All crystals weight are approximate and may differ to images. 

Only one Crystal supplied.

Product Code: geVxGQo
Product Condition: New
Related Products
Black Obsidian Polished..
Black Obsidian Polished..
£1.50
Black Petrified Wood Po..
Black Petrified Wood Po..
£1.50
Red Jasper Polished Tum..
Red Jasper Polished Tum..
£1.50
Garnet Polished Tumble ..
Garnet Polished Tumble ..
£2.50
Lava Stone Tumble Stone
Lava Stone Tumble Stone
£2.50
Red Dalmatian Jasper Po..
Red Dalmatian Jasper Po..
£2.50
Snowflake Obsidian Poli..
Snowflake Obsidian Poli..
£2.50
Shungite Polished Tumbl..
Shungite Polished Tumbl..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract