GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Malachite Polished Tumble Stone

Malachite Polished Tumble Stone

£5.00 inc. tax

Malachite polished tumble stone a Crystal for protection. Supporting transformation and growth. 

Malachite supports Heart chakra.

Associated with star sign Taurus.

All crystals weight are approximate and may differ to image. 

Only one Crystal supplied.

Product Code: iV4KsJo
Product Condition: New
Related Products
Serpentine Polished Tum..
Serpentine Polished Tum..
£1.50
Picture Jasper Polished..
Picture Jasper Polished..
£1.50
Green Picture Jasper Po..
Green Picture Jasper Po..
£1.50
Green Aventurine Polish..
Green Aventurine Polish..
£1.50
Aragonite Polished Tumb..
Aragonite Polished Tumb..
£2.50
Bloodstone Polished Tum..
Bloodstone Polished Tum..
£2.50
Green Dalmatian Jasper ..
Green Dalmatian Jasper ..
£2.50
Amazonite Polished Tumb..
Amazonite Polished Tumb..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract