GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Turquoise polished tumble stone

Turquoise polished tumble stone

£4.50 inc. tax

Turquoise polished tumble stone ideal for mental clarity and clear communication. 

Associated with star sign Sagittarius.


Supports the Throat chakra. 

Only one crystal supplied.

Product Code: TaID0Gj
Product Condition: New
Related Products
Blue Quartz Polished Tu..
Blue Quartz Polished Tu..
£1.50
Clear Quartz Polished T..
Clear Quartz Polished T..
£1.50
Angelite Polished Tumbl..
Angelite Polished Tumbl..
£2.50
Apatite Polished Tumble..
Apatite Polished Tumble..
£2.50
Blue Howlite Polished T..
Blue Howlite Polished T..
£2.50
Blue Goldstone Polished..
Blue Goldstone Polished..
£2.50
Amazonite Polished Tumb..
Amazonite Polished Tumb..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract