GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Wild Whispers Oracle Cards
Wild Whispers Oracle Cards

Wild Whispers Oracle Cards

£19.00 inc. tax

Wild Whispers oracle cards, transformative truths from the wild. Listen closely to the whispers of the desert, they carry messages of resilience to your very depths. 44 oracle cards complete with guidebook. 

Product Code: y1ywPu0
Brand: Nat Girsberger
Product Condition: New
Related Products
The Green Witch’s Magic..
The Green Witch’s Magic..
£17.99
Angels and Auras Oracle..
Angels and Auras Oracle..
£17.99
Energy oracle card deck
Energy oracle card deck
£17.99
Urban Crow Oracle Cards
Urban Crow Oracle Cards
£19.00
Sacred Destiny Oracle c..
Sacred Destiny Oracle c..
£20.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract