GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Honey Jade Crystal chip bracelet

Honey Jade Crystal chip bracelet

£3.50 inc. tax

Honey Jade Crystal chip bracelet. Honey Jade Crystal brings joy, happiness and boosts self- confidence. 

Associated with star signs Gemini and Libra.

Supports the Solar plexus chakra. 

Product Code: m2dpI4n
Product Condition: New
Related Products
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Sodalite Crystal chip b..
Sodalite Crystal chip b..
£3.50
Green Aventurine Crysta..
Green Aventurine Crysta..
£3.50
Dalmatian Jasper Crysta..
Dalmatian Jasper Crysta..
£4.00
Citrine Crystal chip br..
Citrine Crystal chip br..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract