GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Green Aventurine Crystal chip bracelet

Green Aventurine Crystal chip bracelet

£3.50 inc. tax

Green Aventurine Crystal chip bracelet. Green Aventurine is the Crystal of abundance, supports decision making and motivation. 

Associated with star sign Aries.

Supports the Heart chakra. 

Product Code: bSV5egI
Product Condition: New
Related Products
Honey Jade Crystal chip..
Honey Jade Crystal chip..
£3.50
Peach Aventurine Crysta..
Peach Aventurine Crysta..
£3.50
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Blue Quart Crystal chip..
Blue Quart Crystal chip..
£3.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract