GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Blue Goldstone Crystal chip bracelet

Blue Goldstone Crystal chip bracelet

£4.00 inc. tax

Blue Goldstone Crystal chip bracelet. Offering healing energies, soothes hypersensitivity and increases self-acceptance.

Associated with star signs Gemini Sagittarius.

Supports the crown chakra. 

Product Code: A7LfSY6
Product Condition: New
Related Products
Blue Howlite Crystal ch..
Blue Howlite Crystal ch..
£3.50
Sodalite Crystal chip b..
Sodalite Crystal chip b..
£3.50
Blue Quart Crystal chip..
Blue Quart Crystal chip..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Fluorite Crystal chip b..
Fluorite Crystal chip b..
£4.00
Labradorite Crystal chi..
Labradorite Crystal chi..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract