GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Botswana Agate Crystal chip bracelet

Botswana Agate Crystal chip bracelet

£3.50 inc. tax

Botswana Agate Crystal chip bracelet. Botswana Agate calms the mind and reduces stress. Enhances mental clarity and focus. 

Associated with star signs Gemini and Scorpio.

Supports the Third Eye chakra. 

Product Code: eMkBw2o
Product Condition: New
Related Products
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Tigers Eye Crystal chip..
Tigers Eye Crystal chip..
£3.50
Unakite Crystal chip br..
Unakite Crystal chip br..
£3.50
Howlite Crystal chip br..
Howlite Crystal chip br..
£3.50
Mookaite Crystal chip b..
Mookaite Crystal chip b..
£4.00
Labradorite Crystal chi..
Labradorite Crystal chi..
£4.50
Amethyst Crystal chip b..
Amethyst Crystal chip b..
£4.50
Amazonite Crystal chip ..
Amazonite Crystal chip ..
£4.50
Rhodonite Crystal chip ..
Rhodonite Crystal chip ..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract