GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Blue Howlite Crystal chip bracelet

Blue Howlite Crystal chip bracelet

£3.50 inc. tax

Blue Howlite Crystal chip bracelet, helps calm an over active mind. Helps understanding of dreams and dream recall. 

Associated with star signs Gemini and Virgo.

Supports the Throat chakra.

Product Code: jQcav73
Product Condition: New
Related Products
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Sodalite Crystal chip b..
Sodalite Crystal chip b..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Tigers Eye Crystal chip..
Tigers Eye Crystal chip..
£3.50
Jade Crystal chip brace..
Jade Crystal chip brace..
£3.50
Clear Quartz Crystal ch..
Clear Quartz Crystal ch..
£3.50
Howlite Crystal chip br..
Howlite Crystal chip br..
£3.50
Citrine Crystal chip br..
Citrine Crystal chip br..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract