GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Clear Quartz Crystal chip bracelet

Clear Quartz Crystal chip bracelet

£3.50 inc. tax

Clear Quartz Crystal chip bracelet, an amplifying crystal to supports all crystals and aspects of life. The ultimate Crystal. 

Associated with all star signs.

Supports the Crown chakra.

Product Code: mhCTqRX
Product Condition: New
Related Products
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Howlite Crystal chip br..
Howlite Crystal chip br..
£3.50
Black Obsidian Crystal ..
Black Obsidian Crystal ..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Dalmatian Jasper Crysta..
Dalmatian Jasper Crysta..
£4.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract