GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Black Obsidian Crystal chip bracelet

Black Obsidian Crystal chip bracelet

£3.50 inc. tax

Black Obsidian Crystal chip bracelet, offers protection and grounding. Bringing wisdom. 

Associated with star signs Aries and Scorpio.

Supports the Base chakra.

Product Code: ZnRvVQ9
Product Condition: New
Related Products
Red Jasper Crystal chip..
Red Jasper Crystal chip..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Rose Quartz Crystal chi..
Rose Quartz Crystal chi..
£3.50
Blue Goldstone Crystal ..
Blue Goldstone Crystal ..
£4.00
Smoky Quartz Crystal ch..
Smoky Quartz Crystal ch..
£4.50
Hematite Crystal chip b..
Hematite Crystal chip b..
£4.50
Sunstone Crystal chip b..
Sunstone Crystal chip b..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract