GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Amethyst Crystal chip bracelet

Amethyst Crystal chip bracelet

£4.50 inc. tax

Amethyst Crystal chip bracelet, the Crystal of intuition, calm and balance. Enhances spirituality. 

Associated with star signs Virgo and Pisces.

Supports the Crown chakra.

Product Code: T40uR0v
Product Condition: New
Related Products
Clear Quartz Crystal ch..
Clear Quartz Crystal ch..
£3.50
Fluorite Crystal chip b..
Fluorite Crystal chip b..
£4.00
Smoky Quartz Crystal ch..
Smoky Quartz Crystal ch..
£4.50
Labradorite Crystal chi..
Labradorite Crystal chi..
£4.50
Rhodonite Crystal chip ..
Rhodonite Crystal chip ..
£4.50
Sunstone Crystal chip b..
Sunstone Crystal chip b..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract