GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Sunstone Crystal chip bracelet

Sunstone Crystal chip bracelet

£5.50 inc. tax

Sunstone crystal chip bracelet, bringing vitality, abundance and longevity. Reduces stress and fear. 

Associated with star signs Leo and Libra.

Supports the sacral chakra.

Product Code: V2vqPu8
Product Condition: New
Related Products
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Carnelian Crystal chip ..
Carnelian Crystal chip ..
£3.50
Honey Jade Crystal chip..
Honey Jade Crystal chip..
£3.50
Tigers Eye Crystal chip..
Tigers Eye Crystal chip..
£3.50
Clear Quartz Crystal ch..
Clear Quartz Crystal ch..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Peach Aventurine Crysta..
Peach Aventurine Crysta..
£3.50
Mookaite Crystal chip b..
Mookaite Crystal chip b..
£4.00
Citrine Crystal chip br..
Citrine Crystal chip br..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract