GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Smoky Quartz Crystal chip bracelet

Smoky Quartz Crystal chip bracelet

£4.50 inc. tax

Smoky Quartz Crystal chip bracelet, offering protection against negativity. Good for grounding, relaxation and meditation. 

Associated with star signs Sagittarius and Capricorn.

Supports Base chakra. 

Product Code: Bj5JcWC
Product Condition: New
Related Products
Red Jasper Crystal chip..
Red Jasper Crystal chip..
£3.50
Carnelian Crystal chip ..
Carnelian Crystal chip ..
£3.50
Tigers Eye Crystal chip..
Tigers Eye Crystal chip..
£3.50
Mookaite Crystal chip b..
Mookaite Crystal chip b..
£4.00
Hematite Crystal chip b..
Hematite Crystal chip b..
£4.50
Garnet Crystal chip bra..
Garnet Crystal chip bra..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract