GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Tigers Eye Crystal chip bracelet

Tigers Eye Crystal chip bracelet

£3.50 inc. tax

Tigers eye Crystal chip bracelet, great for grounding and bringing calm. Encourages courage and new beginnings. 

Associated with star sign Capricorn.

Supports the Solar plexus chakra. 

Product Code: sMjDo6L
Product Condition: New
Related Products
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Red Jasper Crystal chip..
Red Jasper Crystal chip..
£3.50
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Black Obsidian Crystal ..
Black Obsidian Crystal ..
£3.50
Mookaite Crystal chip b..
Mookaite Crystal chip b..
£4.00
Dalmatian Jasper Crysta..
Dalmatian Jasper Crysta..
£4.00
Hematite Crystal chip b..
Hematite Crystal chip b..
£4.50
Smoky Quartz Crystal ch..
Smoky Quartz Crystal ch..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract