GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Mookaite Crystal chip bracelet

Mookaite Crystal chip bracelet

£4.00 inc. tax

Mookaite Crystal chip bracelet. Good for grounding and building self-esteem. Supports decision making and creativity. 

Associated with star sign Leo.

Supports Base chakra. 

Product Code: GH0Ji0d
Product Condition: New
Related Products
Honey Jade Crystal chip..
Honey Jade Crystal chip..
£3.50
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Fluorite Crystal chip b..
Fluorite Crystal chip b..
£4.00
Labradorite Crystal chi..
Labradorite Crystal chi..
£4.50
Hematite Crystal chip b..
Hematite Crystal chip b..
£4.50
Amethyst Crystal chip b..
Amethyst Crystal chip b..
£4.50
Rhodonite Crystal chip ..
Rhodonite Crystal chip ..
£4.50
Amazonite Crystal chip ..
Amazonite Crystal chip ..
£4.50
Sunstone Crystal chip b..
Sunstone Crystal chip b..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract