GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Rose Quartz Crystal chip bracelet

Rose Quartz Crystal chip bracelet

£3.50 inc. tax

Rose Quartz crystal chip bracelet,  a Crystal for love, promoting self-love and forgiveness. 

Associated with star signs Capricorn Taurus.

Supports the heart chakra. 

Product Code: v2JC4Cf
Product Condition: New
Related Products
Unakite Crystal chip br..
Unakite Crystal chip br..
£3.50
Peach Aventurine Crysta..
Peach Aventurine Crysta..
£3.50
Fluorite Crystal chip b..
Fluorite Crystal chip b..
£4.00
Dalmatian Jasper Crysta..
Dalmatian Jasper Crysta..
£4.00
Amethyst Crystal chip b..
Amethyst Crystal chip b..
£4.50
Rhodonite Crystal chip ..
Rhodonite Crystal chip ..
£4.50
Garnet Crystal chip bra..
Garnet Crystal chip bra..
£5.50
Sunstone Crystal chip b..
Sunstone Crystal chip b..
£5.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract