GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Garnet Crystal chip bracelet

Garnet Crystal chip bracelet

£5.50 inc. tax

Garnet Crystal chip bracelet, brings courage, vitality, abundance and creative energy. Supports emotional balance. 

Associates with star signs Capricorn and Aquarius.

Supports the Base chakra. 

Product Code: SjF4R4d
Product Condition: New
Related Products
Black Obsidian Crystal ..
Black Obsidian Crystal ..
£3.50
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Clear Quartz Crystal ch..
Clear Quartz Crystal ch..
£3.50
Fluorite Crystal chip b..
Fluorite Crystal chip b..
£4.00
Amazonite Crystal chip ..
Amazonite Crystal chip ..
£4.50
Amethyst Crystal chip b..
Amethyst Crystal chip b..
£4.50
Rhodonite Crystal chip ..
Rhodonite Crystal chip ..
£4.50
Smoky Quartz Crystal ch..
Smoky Quartz Crystal ch..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract