GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Hematite Crystal chip bracelet

Hematite Crystal chip bracelet

£4.50 inc. tax

Hematite Crystal chip bracelet, bringing grounding energies and connection to earth. 

Associated with star signs Aquarius and Aries. 

Supports the Base chakra. 

Product Code: h9St5D0
Product Condition: New
Related Products
Zebra Jasper Crystal ch..
Zebra Jasper Crystal ch..
£3.50
Botswana Agate Crystal ..
Botswana Agate Crystal ..
£3.50
Picture Jasper Crystal ..
Picture Jasper Crystal ..
£3.50
Black Obsidian Crystal ..
Black Obsidian Crystal ..
£3.50
Peach Aventurine Crysta..
Peach Aventurine Crysta..
£3.50
Mookaite Crystal chip b..
Mookaite Crystal chip b..
£4.00
Smoky Quartz Crystal ch..
Smoky Quartz Crystal ch..
£4.50
Labradorite Crystal chi..
Labradorite Crystal chi..
£4.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract